This is a working overview of quality control, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-08-15 and is reviewed periodically as new material appears.
Reported purity values can differ between laboratories even for the same sample. Variations arise from column chemistry, mobile-phase composition, gradient slope, detection wavelength, injection load, and integration rules. Area percent also assumes that all species have similar response factors, which is not always true. Method validation examines specificity, linearity, accuracy, precision, limit of detection, and limit of quantitation. When comparing certificates, the method description and representative chromatogram are as important as the headline percentage.
Purity and potency are related but distinct concepts in peptide testing. Purity describes the proportion of the main peptide relative to other detected substances, while potency refers to the biological or functional activity of a defined amount. A highly pure peptide can still have low potency if it is misfolded, aggregated, or chemically modified at a critical residue. Conversely, a less pure preparation may retain high activity if the impurities are inactive. Clear reporting separates these attributes and states the assay used for each.
Regulatory and accreditation expectations depend on the peptide's intended use. Research reagents may be tested with in-house methods, while pharmaceutical development follows validated procedures and pharmacopeial chapters where applicable. Method validation commonly examines accuracy, precision, specificity, linearity, range, and limits of detection and quantitation. Laboratories accredited to ISO/IEC 17025 must document competence, equipment calibration, and uncertainty. Comparing purity results across laboratories remains difficult because different columns, gradients, detection wavelengths, and integration rules can change reported values; open questions include how best to standardize impurity identification and reporting for diverse peptide products.
Quality control for peptides places purity testing within a documented system that includes specifications, test methods, and acceptance criteria. A certificate of analysis typically reports appearance, chromatographic purity, mass confirmation, and storage conditions. System suitability checks, blank injections, and reference standards help ensure that an analytical run is valid. Traceability requires records of sample preparation, instrument settings, and data processing. No single purity threshold applies to all peptides or uses, so specifications are set according to the intended application and risk assessment.
| Property | Value | Notes |
|---|---|---|
| Typical purity specification | 95% or 98% area by RP-HPLC | Grade and application dependent |
| Common identity test | Electrospray ionization mass spectrometry | Confirms molecular mass |
| Typical water content method | Karl Fischer titration | Reports residual moisture |
| Common counterion test | Ion chromatography | Detects trifluoroacetate or acetate |
| Typical validation elements | Specificity, linearity, precision, accuracy | Follows method-validation guidance |
Independent verification is used when a supplier result needs confirmation or when a material supports regulated work. A second laboratory can repeat reverse-phase HPLC and mass spectrometry on the same sample. Discrepancies may arise from different columns, gradients, detection wavelengths, or sample preparation. Moisture uptake and counterion content can lower net peptide mass without changing area percent. Documentation of methods and raw data helps distinguish analytical variation from a true quality difference.
Quality control for peptides begins with a documented specification that states the required purity, identity, and appearance. Suppliers often release research-grade material at 95% or greater by HPLC area, but this threshold is not universal. A certificate of analysis typically records the lot number, sequence, test methods, and measured values. The document allows a user to compare batches and to trace deviations. Specifications should match the intended use rather than a generic label.
Quality control specifications for peptides typically include appearance, identity, purity by RP-HPLC, water content, counterion content, and residual trifluoroacetic acid. Karl Fischer titration measures water, while ion chromatography or elemental analysis can quantify counterions. Purity specifications may be set at 95% or 98% area percent, but the appropriate threshold depends on the application. For research reagents, a lower purity may be acceptable if identity is confirmed. For assays sensitive to impurities, higher purity and orthogonal testing are often required.
Handling and storage influence measured purity, and peptides can oxidize, deamidate, aggregate, or adsorb to surfaces over time. Lyophilized powders stored at -20 °C or lower are generally more stable than solutions, though some sequences require different conditions. Repeated freeze-thaw cycles can promote aggregation and loss, so testing after storage checks whether purity has changed. Stability-indicating methods compare stressed and unstressed samples to detect degradation pathways. Light exposure and pH can also accelerate modification.
Solid-phase peptide synthesis can produce truncated sequences when coupling reactions fail. Deletion peptides lack one or more internal residues, while truncation peptides end prematurely. Side reactions include aspartimide formation, oxidation of methionine, and aggregation during chain assembly. Crude synthetic peptides therefore contain target peptide plus related impurities, counterions, residual solvents, and water. Purification by preparative chromatography reduces these impurities but does not remove every closely related species, including some that differ by a single amino acid.
Impurity profiles can include deletion peptides, oxidized forms, truncated sequences, and residual solvents. Some impurities arise during synthesis, cleavage, or purification, while others form during storage. Purity testing often focuses on peptide-related impurities, whereas residual solvents and counterions require separate assays. The significance of a given impurity depends on its amount and properties, which may not be established for a research peptide. Reporting an impurity profile is more informative than reporting a single purity number.
Peptide purity specifications describe the minimum acceptable result from a defined test. A certificate of analysis may list HPLC purity, mass spectrometry identity, appearance, and counterion content. Specifications are method-dependent, so a value obtained with one gradient or wavelength may differ from another. For research use, common thresholds include 95% and 98% by RP-HPLC, but the appropriate limit depends on the application. The specification should always name the analytical method and acceptance criterion.
Agonists PACAP-38 (endogenous peptide agonist, full length version) - also activates other receptors VIP, GPR55 and MRGPRX2 and the Secretin receptor. PACAP-27 (endogenous peptide agonist, shorter fragment which retains activity) Antagonists PACAP(6-38) - N-terminal truncated version of the endogenous peptide agonist which acts as a potent PAC1 antagonist BAY 2686013 PA-915 "VIP and PACAP Receptors: PAC1". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. Human ADCYAP1R1 genome location and ADCYAP1R1 gene details page in the UCSC Genome Browser. This article incorporates text from the United States National Library of Medicine, which is in the public domain.
Some of the oldest forms of biologics are extracted from the bodies of animals, and other humans especially. Important biologics include: Whole blood and other blood components Organ transplantation and tissue transplants Stem-cell therapy Antibodies for passive immunity (e.g., to treat a virus infection) Human reproductive cells Human breast milk Fecal microbiota Some biologics that were previously extracted from animals, such as insulin, are now more commonly produced by recombinant DNA. Biologics can refer to a wide range of biological products in medicine. However, in most cases, the term is used more restrictively for a class of therapeutics (either approved or in development) that are produced using biological processes involving recombinant DNA technology. These medications are usually one of three types:
People can also develop CJD because they carry a mutation of the gene that codes for the prion protein (PRNP), located on chromosome 202p12-pter. This occurs in only 10–15% of all CJD cases. In sporadic cases, the misfolding of the prion protein is a process that is hypothesized to occur as a result of the effects of aging on cellular machinery, explaining why the disease often appears later in life. An EU study determined that "87% of cases were sporadic, 8% genetic, 5% iatrogenic and less than 1% variant." Testing for CJD has historically been problematic, due to the nonspecific nature of early symptoms and difficulty in safely obtaining brain tissue for confirmation. The diagnosis may initially be suspected in a person with rapidly progressing dementia, particularly when it is also found with the characteristic medical signs and symptoms such as involuntary muscle jerking, difficulty with coordination/balance and walking, and visual disturbances. Further testing can support the diagnosis and may include:
In March 2003, Cambridge Antibody Technology (CAT) stated its wish to "initiate discussions regarding the applicability of the royalty offset provisions for Humira" with Abbott Laboratories in the High Court of London. In November 2004, the trial began, and in December 2004, Justice Hugh Laddie ruled for CAT. A short version of the full statement of the proceedings was released. In it Justice Laddie remarked, "Abbott was in error when it made its first royalty payment to CAT calculated on the basis that only 2% of the Net Sales was due. It should have calculated on the basis of the full royalty of just over 5% and should have paid and continued to pay CAT accordingly." Justice Laddie went on to observe "...that the construction advanced by Abbott does violence to the language of the agreements, renders them obscure and makes little or no commercial sense. For this reason CAT wins the action." Abbott was required to pay CAT US$255 million, some of which was to be passed to its partners in development. Of this sum, the Medical Research Council received US$191 million, and in addition, Abbott was asked to pay the MRC a further US$7.5 million over five years from 2006, providing that Humira remains on the market. The MRC also is to receive a further £5.1 million (sterling) in respect of past royalties.
Clustal Omega is a multiple sequence alignment (MSA) tool that enables to find an optimal alignment of at least three and maximum of 4000 input DNA and protein sequences. Clustal Omega algorithm employs two profile Hidden Markov models (HMMs) to derive the final alignment of the sequences. The output of the Clustal Omega may be visualized in a guide tree (the phylogenetic relationship of the best-pairing sequences) or ordered by the mutual sequence similarity between the queries. The main advantage of Clustal Omega over other MSA tools (Muscle, ProbCons) is its efficiency, while maintaining a significant accuracy of the results.
Sources: en.wikipedia.org
An anticancer drug is coupled to an antibody that targets a specific tumor antigen (or protein) that, ideally, is only found in or on tumor cells. The biochemical reaction that occurs upon attaching triggers a signal in the tumor cell, which then absorbs, or internalizes, the antibody together with the linked cytotoxin. After the ADC is internalized, the cytotoxin kills the cancer. Their targeting ability was believed to limit side effects for cancer patients and to give a wider therapeutic window than other chemotherapeutic agents, although this promise hasn't yet been realized in the clinic. ADC technologies have been featured in many publications, including scientific journals.
UniProt is an online repository of protein sequence and annotation data, distributed in UniProt Knowledgebase (UniProt KB), UniProt Reference Clusters (UniRef) and UniProt Archive (UniParc) databases. Originally conceived as the individual ventures of EMBL-EBI, Swiss Institute of Bioinformatics (SIB) (together maintaining Swiss-Prot and TrEMBL) and Protein Information Resource (PIR) (housing Protein Sequence Database), the increase in the global protein data generation led to their collaboration in the creation of UniProt in 2002. The protein entries stored in UniProt are cataloged by a unique UniProt identifier. The annotation data collected for the each entry are organized in logical sections (e.g. protein function, structure, expression, sequence or relevant publications), allowing a coordinated overview about the protein of interest. Links to external databases and original sources of data are also provided. In addition to standard search by the protein name/identifier, UniProt webpage houses tools for BLAST searching, sequence alignment or searching for proteins containing specific peptides.
Group specificity occurs when an enzyme will only react with molecules that have specific functional groups, such as aromatic structures, phosphate groups, and methyls. One example is pepsin, an enzyme that is crucial in digestion of foods ingested in our diet, that hydrolyzes peptide bonds in between hydrophobic amino acids, with recognition for aromatic side chains such as phenylalanine, tryptophan, and tyrosine. Another example is hexokinase, an enzyme involved in glycolysis that phosphorylates glucose to produce glucose-6-phosphate. This enzyme exhibits group specificity by allowing multiple hexoses (6 carbon sugars) as its substrate. Glucose is one of the most important substrates in metabolic pathways involving hexokinase due to its role in glycolysis, but is not the only substrate that hexokinase can catalyze a reaction with.
Arrestins (abbreviated Arr) are a small family of proteins important for regulating signal transduction at G protein-coupled receptors. Arrestins were first discovered in the late '80s as a part of a conserved two-step mechanism for regulating the activity of G protein-coupled receptors (GPCRs) in the visual rhodopsin system by Hermann Kühn, Scott Hall, and Ursula Wilden and in the β-adrenergic system by Martin J. Lohse and co-workers.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Another use for affinity chromatography is the purification of specific proteins using a gel matrix that is unique to a specific protein. For example, the purification of E. coli β-galactosidase is accomplished by affinity chromatography using p-aminobenyl-1-thio-β-D-galactopyranosyl agarose as the affinity matrix. p-aminobenyl-1-thio-β-D-galactopyranosyl agarose is used as the affinity matrix because it contains a galactopyranosyl group, which serves as a good substrate analog for E. coli β-Galactosidase. This property allows the enzyme to bind to the stationary phase of the affinity matrix and β-Galactosidase is eluted by adding increasing concentrations of salt to the column. Alkaline phosphatase from E. coli can be purified using a DEAE-Cellulose matrix. A. phosphatase has a slight negative charge, allowing it to weakly bind to the positively charged amine groups in the matrix. The enzyme can then be eluted out by adding buffer with higher salt concentrations.
Tens of thousands of three-dimensional protein structures have been determined by X-ray crystallography and protein nuclear magnetic resonance spectroscopy (protein NMR) and a central question in structural bioinformatics is whether it is practical to predict possible protein–protein interactions only based on these 3D shapes, without performing protein–protein interaction experiments. A variety of methods have been developed to tackle the protein–protein docking problem, though it seems that there is still much work to be done in this field. Other interactions encountered in the field include Protein–ligand (including drug) and protein–peptide. Molecular dynamic simulation of movement of atoms about rotatable bonds is the fundamental principle behind computational algorithms, termed docking algorithms, for studying molecular interactions.
The Bergmann degradation is a series of chemical reactions designed to remove a single amino acid from the carboxylic acid (C-terminal) end of a peptide. First demonstrated by Max Bergmann in 1934, it is a rarely used method for sequencing peptides. The later developed Edman degradation is an improvement upon the Bergmann degradation, instead cleaving the N-terminal amino acid of peptides to produce a hydantoin containing the desired amino acid. The Bergmann degradation follows the earlier work of Bergmann and his close colleague Leonidas Zervas, combining the organic azide degradation of the Curtius rearrangement with the Bergmann-Zervas carbobenzoxy method, which they designed to occur under relatively mild conditions so as to allow peptide sequencing. A single round of the Bergmann degradation yields an aldehyde containing the sought after amino acid residue and the remaining fragment of the original peptide in amide form.
The inverted terminal repeat (ITR) sequences comprise 145 bases each. They were named so because of their symmetry, which was shown to be required for efficient multiplication of the AAV genome. The feature of these sequences that gives them this property is their ability to form a hairpin, which contributes to so-called self-priming that allows primase-independent synthesis of the second DNA strand. The ITRs were also shown to be required for both integration of the AAV DNA into the host cell genome (19th chromosome in humans) and rescue from it, as well as for efficient encapsidation of the AAV DNA combined with generation of a fully assembled, deoxyribonuclease-resistant AAV particles. With regard to gene therapy, ITRs seem to be the only sequences required in cis next to the therapeutic gene: structural (cap) and packaging (rep) proteins can be delivered in trans. With this assumption many methods were established for efficient production of recombinant AAV (rAAV) vectors containing a reporter or therapeutic gene. However, it was also published that the ITRs are not the only elements required in cis for the effective replication and encapsidation. A few research groups have identified a sequence designated cis-acting Rep-dependent element (CARE) inside the coding sequence of the rep gene. CARE was shown to augment the replication and encapsidation when present in cis.
Sources: en.wikipedia.org
Purity percentages vary because each laboratory uses its own column, mobile phase, gradient, detection wavelength, and integration settings. A 95% value from one method may not equal 95% from another method. Comparative assessment requires the same validated procedure or an orthogonal cross-check.
A useful certificate of analysis states the peptide sequence, lot number, test methods, acceptance criteria, and measured results. It typically reports HPLC purity, mass spectrometry identity, water content, counterion content, and residual solvents when relevant. The document should also include a chromatogram and the date of testing.
Higher HPLC purity reduces the relative amount of ultraviolet-detectable impurities, but it does not guarantee correct sequence, stereochemistry, or biological activity. Some impurities may be invisible to the chosen method, and aggregates or counterions may still be present. Fitness for purpose depends on the intended application and the full set of tests.
A certificate of analysis reports test results, methods, and specifications for a peptide lot. It often includes appearance, purity by chromatography, mass confirmation, and storage recommendations. It supports quality assessment but does not by itself guarantee suitability for every application.